Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ompC protein

This E. coli ompC protein spans the amino acid sequence from region 22-367aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer membrane protein 1B Porin OmpC meoA, par

UniProt

P06996

Expression Region

22-367aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD273 monoclonal antibody
MB67189-01 50 µL

CD273 monoclonal antibody

Sign In for Pricing
View Details
CD273 monoclonal antibody
MB67189-02 100 µL

CD273 monoclonal antibody

Sign In for Pricing
View Details
Cullin 3 (CUL3) Human Over-expression Lysate
orb1358007 100 µg

Cullin 3 (CUL3) Human Over-expression Lysate

Sign In for Pricing
View Details
GEMIN4 Protein Vector (Human) (pPM-C-HA)
21438021 500 ng

GEMIN4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Mycobacterium ulcerans Shikimate kinase (aroK)
MBS1255911-01 0.02 mg (E-Coli)

Recombinant Mycobacterium ulcerans Shikimate kinase (aroK)

Sign In for Pricing
View Details
Recombinant Mycobacterium ulcerans Shikimate kinase (aroK)
MBS1255911-02 0.1 mg (E-Coli)

Recombinant Mycobacterium ulcerans Shikimate kinase (aroK)

Sign In for Pricing
View Details