Reptile Naja kaouthia Alpha-cobratoxin protein
This Reptile Naja kaouthia Alpha-cobratoxin protein spans the amino acid sequence from region 1-71aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Alpha-elapitoxin-Nk2a Short name, Alpha-EPTX-Nk2a Long neurotoxin 1 Siamensis 3
UniProt
P01391
Expression Region
1-71aa
Tag
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Naja kaouthia (Monocled cobra) (Naja siamensis)
Field of Research
Epigenetics, Neuroscience
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
37.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740158-500 1x 500 µL
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880525-100 1x 100 µL
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940977-100 1x 100 µL
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680043-100 1x 100 µL
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details