What is the catalog number for Human SPR protein?

The catalog number for Human SPR protein is orb604387.

What sizes are available for Human SPR protein?

Human SPR protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human SPR protein come in?

Human SPR protein is available in 3 different pack sizes.

Is Human SPR protein in stock?

Human SPR protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human SPR protein

This Human SPR protein spans the amino acid sequence from region 1-261aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTTHUMP00000160199, SDR38C1, Sepiapterin reductase (7,8 dihydrobiopterin, NADP+ oxidoreductase), Sepiapterin reductase, Short chain dehydrogenase/reductase family 38C, member 1, SPR, SPRE_HUMAN

UniProt

P35270

Expression Region

1-261aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK