Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Ins1 protein

This Rat Ins1 protein spans the amino acid sequence from region 25-54aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ins-1

UniProt

P01322

Expression Region

25-54aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVKQHLCGPHLVEALYLVCGERGFFYTPKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hrs (phospho Tyr334) Antibody
orb2625098 100 µL

Hrs (phospho Tyr334) Antibody

Sign In for Pricing
View Details
PPFIA2, ID (PPFIA2, Liprin-alpha-2, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-2) (FITC) discontinued
040309-FITC 200 µL

PPFIA2, ID (PPFIA2, Liprin-alpha-2, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-2) (FITC) discontinued

Sign In for Pricing
View Details
TRP2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2509489 100 µL

TRP2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
COL24A1 3'UTR Luciferase Stable Cell Line
TU004797 1.0 mL

COL24A1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ABCF2 Polyclonal Antibody
RA21549-01 50 µL

ABCF2 Polyclonal Antibody

Sign In for Pricing
View Details
ABCF2 Polyclonal Antibody
RA21549-02 100 µL

ABCF2 Polyclonal Antibody

Sign In for Pricing
View Details