Human TSG101 protein
This Human TSG101 protein spans the amino acid sequence from region 1-145aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ESCRT-I complex subunit TSG101
UniProt
Q99816
Expression Region
1-145aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics, Infectious Diseases
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
36.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2138737-01 0.1 mL
Monoclonal Antibody to Nitric Oxide Synthase 1, Neuronal (NOS1)
Sign In for Pricing
View Details MBS2138737-02 0.2 mL
Monoclonal Antibody to Nitric Oxide Synthase 1, Neuronal (NOS1)
Sign In for Pricing
View Details MBS2138737-03 0.5 mL
Monoclonal Antibody to Nitric Oxide Synthase 1, Neuronal (NOS1)
Sign In for Pricing
View Details MBS2138737-04 1 mL
Monoclonal Antibody to Nitric Oxide Synthase 1, Neuronal (NOS1)
Sign In for Pricing
View Details MBS2138737-05 5 mL
Monoclonal Antibody to Nitric Oxide Synthase 1, Neuronal (NOS1)
Sign In for Pricing
View Details