Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TSG101 protein

This Human TSG101 protein spans the amino acid sequence from region 1-145aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ESCRT-I complex subunit TSG101

UniProt

Q99816

Expression Region

1-145aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics, Infectious Diseases

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPRID2 Human Pre-designed siRNA Set A
HY-RS06994 1 Set

ITPRID2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Galectin-3 Monoclonal Antibody (A3A12)
M03861 100 µg

Anti-Galectin-3 Monoclonal Antibody (A3A12)

Sign In for Pricing
View Details
Anti-Phospho-ATM (Ser1987) Polyclonal Antibody
TMAC-00330-01 50 μL

Anti-Phospho-ATM (Ser1987) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-ATM (Ser1987) Polyclonal Antibody
TMAC-00330-02 100 µL

Anti-Phospho-ATM (Ser1987) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-EGFR (Tyr998) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-3112R-PerCP-Cy5.5 100 µL

Phospho-EGFR (Tyr998) Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Caspase 7 monoclonal antibody
orb1722905-01 50 µL

Caspase 7 monoclonal antibody

Sign In for Pricing
View Details