Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF1 protein

This Human IGF1 protein spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mechano growth factor Somatomedin-C IBP1

UniProt

P05019

Expression Region

49-118aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HUWE1 ELISA Kit (Mouse) (OKEH03504)
OKEH03504 96 Well

HUWE1 ELISA Kit (Mouse) (OKEH03504)

Sign In for Pricing
View Details
2-Bromo-1,5-dichloro-3- (trifluoromethyl) benzene
PC1024390-01 250 mg

2-Bromo-1,5-dichloro-3- (trifluoromethyl) benzene

Sign In for Pricing
View Details
2-Bromo-1,5-dichloro-3- (trifluoromethyl) benzene
PC1024390-02 500 mg

2-Bromo-1,5-dichloro-3- (trifluoromethyl) benzene

Sign In for Pricing
View Details
2-Bromo-1,5-dichloro-3- (trifluoromethyl) benzene
PC1024390-03 1 g

2-Bromo-1,5-dichloro-3- (trifluoromethyl) benzene

Sign In for Pricing
View Details
2-Bromo-1,5-dichloro-3- (trifluoromethyl) benzene
PC1024390-04 5 g

2-Bromo-1,5-dichloro-3- (trifluoromethyl) benzene

Sign In for Pricing
View Details
2-Bromo-1,5-dichloro-3- (trifluoromethyl) benzene
PC1024390-05 10 g

2-Bromo-1,5-dichloro-3- (trifluoromethyl) benzene

Sign In for Pricing
View Details