Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF1 protein

This Human IGF1 protein spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mechano growth factor Somatomedin-C IBP1

UniProt

P05019

Expression Region

49-118aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1359460 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7219706 1.0 µg DNA

RGD1359460 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
DFNA27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0587107 1.0 µg DNA

DFNA27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
GSG1 3'UTR Luciferase Stable Cell Line
TU009365 1.0 mL

GSG1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CDY18P ORF Vector (Human) (pORF)
15781011 1.0 µg DNA

CDY18P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Porcine Centromere protein U (MLF1IP) ELISA kit
GTR10443384 96 Well

Porcine Centromere protein U (MLF1IP) ELISA kit

Sign In for Pricing
View Details
Recombinant Human HYAL2
MBS7614510-01 0.05 mg

Recombinant Human HYAL2

Sign In for Pricing
View Details