Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF1 protein

This Human IGF1 protein spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mechano growth factor Somatomedin-C IBP1

UniProt

P05019

Expression Region

49-118aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Programmed Cell Death Protein 1 Ligand 2 ELISA Kit (PDCD1LG2)
RK02037 96 Tests

Human Programmed Cell Death Protein 1 Ligand 2 ELISA Kit (PDCD1LG2)

Sign In for Pricing
View Details
Porcine Breast and Kidney Expressed Chemokine ELISA Kit
MBS019804-01 48 Well

Porcine Breast and Kidney Expressed Chemokine ELISA Kit

Sign In for Pricing
View Details
Porcine Breast and Kidney Expressed Chemokine ELISA Kit
MBS019804-02 96 Well

Porcine Breast and Kidney Expressed Chemokine ELISA Kit

Sign In for Pricing
View Details
Porcine Breast and Kidney Expressed Chemokine ELISA Kit
MBS019804-03 5x 96 Well

Porcine Breast and Kidney Expressed Chemokine ELISA Kit

Sign In for Pricing
View Details
Porcine Breast and Kidney Expressed Chemokine ELISA Kit
MBS019804-04 10x 96 Well

Porcine Breast and Kidney Expressed Chemokine ELISA Kit

Sign In for Pricing
View Details
ANKRD50 Knockout HAP1 Polyclonal Cells
ARG27266 1 Million

ANKRD50 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details