Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPLP2 protein

This Human RPLP2 protein spans the amino acid sequence from region 1-115aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Large ribosomal subunit protein P2 Renal carcinoma antigen NY-REN-44 D11S2243E, RPP2

UniProt

P05387

Expression Region

1-115aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX6 siRNA (Human)
CRH1168-01 15 nmol

DDX6 siRNA (Human)

Sign In for Pricing
View Details
DDX6 siRNA (Human)
CRH1168-02 30 nmol

DDX6 siRNA (Human)

Sign In for Pricing
View Details
RPS3AP39 CRISPR All-in-one AAV vector set (with saCas9)(Human)
42528151 3x 1.0 µg DNA

RPS3AP39 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
RGD1306626 Protein Lysate (Rat) with C-HA Tag
38977036 100 µg

RGD1306626 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Anti-Fucose Mutarotase Antibody, Rabbit Polyclonal
MBS8107206-01 0.1 mL

Anti-Fucose Mutarotase Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Fucose Mutarotase Antibody, Rabbit Polyclonal
MBS8107206-02 5x 0.1 mL

Anti-Fucose Mutarotase Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details