Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPLP2 protein

This Human RPLP2 protein spans the amino acid sequence from region 1-115aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Large ribosomal subunit protein P2 Renal carcinoma antigen NY-REN-44 D11S2243E, RPP2

UniProt

P05387

Expression Region

1-115aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plxdc2 Antibody
24616 100 µL

Plxdc2 Antibody

Sign In for Pricing
View Details
Lentiviral human H4C2 shRNA (UAS) - Lentiviral human H4C2 shRNA (UAS) (25)
GTR15351560 1 Vial

Lentiviral human H4C2 shRNA (UAS) - Lentiviral human H4C2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Guselkumab Non-Neutralizing Antibody
orb3155145-01 50 µg

Guselkumab Non-Neutralizing Antibody

Sign In for Pricing
View Details
Guselkumab Non-Neutralizing Antibody
orb3155145-02 100 µg

Guselkumab Non-Neutralizing Antibody

Sign In for Pricing
View Details
APC5 (Anaphase-promoting complex subunit 5)
305949-01 50 µg

APC5 (Anaphase-promoting complex subunit 5)

Sign In for Pricing
View Details
APC5 (Anaphase-promoting complex subunit 5)
305949-02 100 µg

APC5 (Anaphase-promoting complex subunit 5)

Sign In for Pricing
View Details