Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPLP2 protein

This Human RPLP2 protein spans the amino acid sequence from region 1-115aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Large ribosomal subunit protein P2 Renal carcinoma antigen NY-REN-44 D11S2243E, RPP2

UniProt

P05387

Expression Region

1-115aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans ncl-1 Polyclonal Antibody
MBS7154187 Inquire

Rabbit anti-Caenorhabditis elegans ncl-1 Polyclonal Antibody

Sign In for Pricing
View Details
Human Mucin-4 (Muc4) Elisa Kit
EKC41794 96 Tests

Human Mucin-4 (Muc4) Elisa Kit

Sign In for Pricing
View Details
Bovine Glutamate Receptor, Ionotropic, Kainate 2 ELISA Kit
OM617847 96 Strip Well

Bovine Glutamate Receptor, Ionotropic, Kainate 2 ELISA Kit

Sign In for Pricing
View Details
Rat ATG13 (autophagy protein 13) ELISA Kit
MBS7612442-01 48 Well

Rat ATG13 (autophagy protein 13) ELISA Kit

Sign In for Pricing
View Details
Rat ATG13 (autophagy protein 13) ELISA Kit
MBS7612442-02 96 Well

Rat ATG13 (autophagy protein 13) ELISA Kit

Sign In for Pricing
View Details
Rat ATG13 (autophagy protein 13) ELISA Kit
MBS7612442-03 5x 96 Well

Rat ATG13 (autophagy protein 13) ELISA Kit

Sign In for Pricing
View Details