Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT4 protein

This Human MT4 protein spans the amino acid sequence from region 1-62aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-IV

UniProt

P47944

Expression Region

1-62aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish METAP2a/b Antibody Picoband® Fluoro488 Conjugated
AZA5WVX8-Fluoro488 100 µg/Vial

Anti-Zebrafish METAP2a/b Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Buffer Solution pH 9.2 ±0.05 @ 25°c
B0058 00500 500 mL

Buffer Solution pH 9.2 ±0.05 @ 25°c

Sign In for Pricing
View Details
BMP6 (Bone Morphogenetic Protein 6, BMP 6, VG-1-Related Protein, VG-1-R, VGR-1, BMP-6, VGR) (Precursor Specific)
351771 100 µL

BMP6 (Bone Morphogenetic Protein 6, BMP 6, VG-1-Related Protein, VG-1-R, VGR-1, BMP-6, VGR) (Precursor Specific)

Sign In for Pricing
View Details
SLC25A6 (ADP/ATP Translocase 3, ADP,ATP Carrier Protein 3, ADP,ATP Carrier Protein, Isoform T2, ANT 2, Adenine Nucleotide Translocator 3, ANT 3, Solute Carrier Family 25 Member 6, ANT3, CDABP0051) APC
MBS6394301-01 0.1 mL

SLC25A6 (ADP/ATP Translocase 3, ADP,ATP Carrier Protein 3, ADP,ATP Carrier Protein, Isoform T2, ANT 2, Adenine Nucleotide Translocator 3, ANT 3, Solute Carrier Family 25 Member 6, ANT3, CDABP0051) APC

Sign In for Pricing
View Details
SLC25A6 (ADP/ATP Translocase 3, ADP,ATP Carrier Protein 3, ADP,ATP Carrier Protein, Isoform T2, ANT 2, Adenine Nucleotide Translocator 3, ANT 3, Solute Carrier Family 25 Member 6, ANT3, CDABP0051) APC
MBS6394301-02 5x 0.1 mL

SLC25A6 (ADP/ATP Translocase 3, ADP,ATP Carrier Protein 3, ADP,ATP Carrier Protein, Isoform T2, ANT 2, Adenine Nucleotide Translocator 3, ANT 3, Solute Carrier Family 25 Member 6, ANT3, CDABP0051) APC

Sign In for Pricing
View Details
RPS6KA2 siRNA (Mouse)
MBS827090-01 15 nmol

RPS6KA2 siRNA (Mouse)

Sign In for Pricing
View Details