Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT4 protein

This Human MT4 protein spans the amino acid sequence from region 1-62aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-IV

UniProt

P47944

Expression Region

1-62aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP28 ORF Vector (Human) (pORF)
ORF014994 1.0 µg DNA

ZFP28 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral human ZNF146 shRNA (UAS) - Lentiviral human ZNF146 shRNA (UAS, GFP) (100)
GTR15344016 1 Vial

Lentiviral human ZNF146 shRNA (UAS) - Lentiviral human ZNF146 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
MyD88 Rabbit Polyclonal Antibody (PerCP)
orb1582587 100 µL

MyD88 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Vmn2r122 3'UTR Luciferase Stable Cell Line
TU122010 1.0 mL

Vmn2r122 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse Serpin E1/PAI-1 Protein (His Tag)
PKSM041124-01 10 µg

Recombinant Mouse Serpin E1/PAI-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Serpin E1/PAI-1 Protein (His Tag)
PKSM041124-02 50 µg

Recombinant Mouse Serpin E1/PAI-1 Protein (His Tag)

Sign In for Pricing
View Details