Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT4 protein

This Human MT4 protein spans the amino acid sequence from region 1-62aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-IV

UniProt

P47944

Expression Region

1-62aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxy Sulfentrazone
TRC-H977690-2.5MG 2.5 mg

Hydroxy Sulfentrazone

Sign In for Pricing
View Details
Recombinant CDK2 Monoclonal Antibody
E-AB-81426-01 50 µL

Recombinant CDK2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CDK2 Monoclonal Antibody
E-AB-81426-02 100 µL

Recombinant CDK2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse CD200R1 Protein (His Tag)
PKSM040801 100 µg

Recombinant Mouse CD200R1 Protein (His Tag)

Sign In for Pricing
View Details
Zinc Sulfate Heptahydrate
TRC-Z701633-500MG 500 mg

Zinc Sulfate Heptahydrate

Sign In for Pricing
View Details
rac-6-Fluoro-3,4-dihydro-2H-1-benzopyran-2-carboxylic Acid Ethyl Ester
TRC-F590995-250MG 250 mg

rac-6-Fluoro-3,4-dihydro-2H-1-benzopyran-2-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details