Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YAP1 protein

This Human YAP1 protein spans the amino acid sequence from region 1-504aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein yorkie homolog Yes-associated protein YAP65 homolog YAP65

UniProt

P46937

Expression Region

1-504aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)
MBS1393716-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)
MBS1393716-02 0.02 mg (Yeast)

Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)
MBS1393716-03 0.1 mg (E-Coli)

Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)
MBS1393716-04 0.1 mg (Yeast)

Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)
MBS1393716-05 0.02 mg (Baculovirus)

Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)
MBS1393716-06 0.02 mg (Mammalian-Cell)

Recombinant Xenopus laevis Golgi to ER traffic protein 4 homolog A (get4-a)

Sign In for Pricing
View Details