Fungi NCU05495 protein
This Fungi NCU05495 protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
NCU05495Cyanovirin-N homolog, CV-N homolog
UniProt
Q7S6U4
Expression Region
1-111aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
16.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040040-100 1x 100 µL
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040029-500 1x 500 µL
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details