Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus L protein

This Virus L protein spans the amino acid sequence from region 598-784aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Large structural protein Replicase Transcriptase

UniProt

Q8B0H0

Expression Region

598-784aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ICIANHIDYEKWNNHQRKLSNGPVFRVMGQFLGYPSLIERTHEFFEKSLIYYNGRPDLMRVHNNTLVNSTSQRVCWQGQEGGLEGLRQKGWSILNLLVIQREAKIRNTAVKVLAQGDNQVICTQYKTKKSRNVVELQSALNQMVSNNEKIMTAIKIGTGKLGLLINDDETMQSADYLNYGKIPIFRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS37A (NM_001145152) Human Over-expression Lysate
LY428727 100 µg

VPS37A (NM_001145152) Human Over-expression Lysate

Sign In for Pricing
View Details
3- (2,2-Difluoroethoxy) bromobenzene
PC500915-01 100 mg

3- (2,2-Difluoroethoxy) bromobenzene

Sign In for Pricing
View Details
3- (2,2-Difluoroethoxy) bromobenzene
PC500915-02 250 mg

3- (2,2-Difluoroethoxy) bromobenzene

Sign In for Pricing
View Details
3- (2,2-Difluoroethoxy) bromobenzene
PC500915-03 1 g

3- (2,2-Difluoroethoxy) bromobenzene

Sign In for Pricing
View Details
LRTM1 Antibody
A70267-100UG 100 µg

LRTM1 Antibody

Sign In for Pricing
View Details
JMJD1B shRNA (m) Lentiviral Particles
sc-146323-V 200 µL

JMJD1B shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details