Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine Pregnancy-associated protein bPAP protein

This Bovine Pregnancy-associated protein bPAP protein spans the amino acid sequence from region 1-100aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pregnancy-associated protein bPAP, Fragments

UniProt

P84291

Expression Region

1-100aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSELAGPRGARGPHGLSGPHGLSGLSGPSGYTGPIGMSGLTGLRREESEKVWLESKDGQELELVSSGSAQEELELVSSGSAQVSFASYLGASQPLPSELW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Insulin Recombinant Rabbit monoclonal Antibody
HA750004 100 µL

Insulin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
LIME1 Antibody, Biotin conjugated
A70176-100UG 100 µg

LIME1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
P70 S6 kinase α Polyclonal Antibody
RA28447-01 50 µL

P70 S6 kinase α Polyclonal Antibody

Sign In for Pricing
View Details
P70 S6 kinase α Polyclonal Antibody
RA28447-02 100 µL

P70 S6 kinase α Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Heart
CS631999 5x 5 µm

Frozen Tissue Sections, Heart

Sign In for Pricing
View Details
Sn-Glycero-3-phosphocholine (Standard)
HY-17552R-01 25 mg

Sn-Glycero-3-phosphocholine (Standard)

Sign In for Pricing
View Details