Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRDX1 protein

This Human PRDX1 protein spans the amino acid sequence from region 1-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Natural killer cell-enhancing factor A Proliferation-associated gene protein Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2 PAGA, PAGB, TDPX2

UniProt

Q06830

Expression Region

1-199aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3,4-Dimethoxy-benzyl) - (1,2-dimethyl-1H-benzoimidazol-5-yl) -amine
MNA92560-01 5000 mg

(3,4-Dimethoxy-benzyl) - (1,2-dimethyl-1H-benzoimidazol-5-yl) -amine

Sign In for Pricing
View Details
(3,4-Dimethoxy-benzyl) - (1,2-dimethyl-1H-benzoimidazol-5-yl) -amine
MNA92560-02 10000 mg

(3,4-Dimethoxy-benzyl) - (1,2-dimethyl-1H-benzoimidazol-5-yl) -amine

Sign In for Pricing
View Details
Rpl37 Rat Pre-designed siRNA Set A
HY-RS29299 1 Set

Rpl37 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human TAP1, N-His
ARO-P12869-01 50 µg

Recombinant Human TAP1, N-His

Sign In for Pricing
View Details
Recombinant Human TAP1, N-His
ARO-P12869-02 100 µg

Recombinant Human TAP1, N-His

Sign In for Pricing
View Details
Recombinant Human TAP1, N-His
ARO-P12869-03 1 mg

Recombinant Human TAP1, N-His

Sign In for Pricing
View Details