Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Interferon gamma protein

This Human Interferon gamma protein spans the amino acid sequence from region 23-125aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gamma-interferon-induced monokine Monokine induced by interferon-gamma CMK, MIG, SCYB9

UniProt

Q07325

Expression Region

23-125aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Valnemulin
V016-5MG 5 mg

Valnemulin

Sign In for Pricing
View Details
STAM2, ID (STAM2, HBP, Signal transducing adapter molecule 2, Hrs-binding protein) (MaxLight 750)
MBS6351695-01 0.1 mL

STAM2, ID (STAM2, HBP, Signal transducing adapter molecule 2, Hrs-binding protein) (MaxLight 750)

Sign In for Pricing
View Details
STAM2, ID (STAM2, HBP, Signal transducing adapter molecule 2, Hrs-binding protein) (MaxLight 750)
MBS6351695-02 5x 0.1 mL

STAM2, ID (STAM2, HBP, Signal transducing adapter molecule 2, Hrs-binding protein) (MaxLight 750)

Sign In for Pricing
View Details
Ubiquicidin (29-41)
HY-P10364-01 5 mg

Ubiquicidin (29-41)

Sign In for Pricing
View Details
Ubiquicidin (29-41)
HY-P10364-02 10 mg

Ubiquicidin (29-41)

Sign In for Pricing
View Details
Ubiquicidin (29-41)
HY-P10364-03 25 mg

Ubiquicidin (29-41)

Sign In for Pricing
View Details