Mouse Dbil5 protein
This Mouse Dbil5 protein spans the amino acid sequence from region 1-87aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Endozepine-like peptide
UniProt
O09035
Expression Region
1-87aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
13.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6358769-01 0.2 mL
TRNAU1AP, ID (TRNAU1AP, SECP43, TRSPAP1, tRNA selenocysteine 1-associated protein 1, SECp43, tRNA selenocysteine-associated protein 1) (PE)
Sign In for Pricing
View Details MBS6358769-02 5x 0.2 mL
TRNAU1AP, ID (TRNAU1AP, SECP43, TRSPAP1, tRNA selenocysteine 1-associated protein 1, SECp43, tRNA selenocysteine-associated protein 1) (PE)
Sign In for Pricing
View Details 
MBS6429874-01 0.1 mL
NTRK2, Phosphorylated (Y705) (Neurotrophic Tyrosine Kinase Receptor Type 2, TRKB, trk-B, GP145-TrkB) (APC)
Sign In for Pricing
View Details MBS6429874-02 5x 0.1 mL
NTRK2, Phosphorylated (Y705) (Neurotrophic Tyrosine Kinase Receptor Type 2, TRKB, trk-B, GP145-TrkB) (APC)
Sign In for Pricing
View Details 