Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Dbil5 protein

This Mouse Dbil5 protein spans the amino acid sequence from region 1-87aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endozepine-like peptide

UniProt

O09035

Expression Region

1-87aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL4A3BP Rabbit Polyclonal Antibody (BF680)
orb2414091 100 µL

COL4A3BP Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Med6 Protein Vector (Mouse) (pPB-C-His)
PV200130 500 ng

Med6 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
TRNAQ42P 3'UTR GFP Stable Cell Line
TU077071 1.0 mL

TRNAQ42P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Antidiuretic Hormone/Vasopressin/Arginine Vasopressin (ADH/VP/AVP) Monkey ELISA Kit
B2939 96 Tests

Antidiuretic Hormone/Vasopressin/Arginine Vasopressin (ADH/VP/AVP) Monkey ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r38 shRNA (UAS) - Lentiviral mouse Vmn1r38 shRNA (UAS, iRFP) (25)
GTR15126986 1 Vial

Lentiviral mouse Vmn1r38 shRNA (UAS) - Lentiviral mouse Vmn1r38 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
DPRX (NM_001012728) Human Over-expression Lysate
LS503834-20ug 20 µg

DPRX (NM_001012728) Human Over-expression Lysate

Sign In for Pricing
View Details