Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6G6D protein

This Human LY6G6D protein spans the amino acid sequence from region 20-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Megakaryocyte-enhanced gene transcript 1 protein C6orf23, G6D, MEGT1, NG25

UniProt

O95868

Expression Region

20-104aa

Tag

N-terminal 10xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAS4 (NM_017843) Human Tagged Lenti ORF Clone
RC215772L3 10 µg

BCAS4 (NM_017843) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GAA Peptide - N-terminal region (AAP44227)
AAP44227-100UG 100 µg

GAA Peptide - N-terminal region (AAP44227)

Sign In for Pricing
View Details
Trk A discontinued
346342-01 100 µL

Trk A discontinued

Sign In for Pricing
View Details
Trk A discontinued
346342-02 200 µL

Trk A discontinued

Sign In for Pricing
View Details
ZFAND2B CRISPR/Cas9 KO Plasmid (m)
sc-427194 20 µg

ZFAND2B CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Mouse Monoclonal CCL8/MCP-2 Antibody (CCL8/3686) [Janelia Fluor 585]
NBP3-14174JF585 0.1 mL

Mouse Monoclonal CCL8/MCP-2 Antibody (CCL8/3686) [Janelia Fluor 585]

Sign In for Pricing
View Details