Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6G6D protein

This Human LY6G6D protein spans the amino acid sequence from region 20-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Megakaryocyte-enhanced gene transcript 1 protein C6orf23, G6D, MEGT1, NG25

UniProt

O95868

Expression Region

20-104aa

Tag

N-terminal 10xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTDR1 Protein Vector (Mouse) (pPM-C-HA)
PV226032 500 ng

RTDR1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lens Culinaris Agglutinin
orb2942579-01 10 mg

Lens Culinaris Agglutinin

Sign In for Pricing
View Details
Lens Culinaris Agglutinin
orb2942579-02 25 mg

Lens Culinaris Agglutinin

Sign In for Pricing
View Details
VDAC-1 Antibody
251931 0.1 mg

VDAC-1 Antibody

Sign In for Pricing
View Details
HECW1 Antibody, FITC conjugated
CSB-PA748484HC01HU-01 50 μL

HECW1 Antibody, FITC conjugated

Sign In for Pricing
View Details
HECW1 Antibody, FITC conjugated
CSB-PA748484HC01HU-02 100 µL

HECW1 Antibody, FITC conjugated

Sign In for Pricing
View Details