Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NUDT1 protein

This Human NUDT1 protein spans the amino acid sequence from region 19-197aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2-hydroxy-dATP diphosphatase (EC, 3.6.1.56) 8-oxo-dGTPase Nucleoside diphosphate-linked moiety X motif 1 MTH1

UniProt

P36639

Expression Region

19-197aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHIN1
BA8348-5 5 mg

SHIN1

Sign In for Pricing
View Details
Complement Component C8 (Complement C8, Complement Component C8 alpha Chain, Complement Component 8 alpha Polypeptide, Complement Component 8 Subunit alpha, C8A, Complement Component C8 beta Chain, Complement Component 8 beta Polypeptide, Complement Compo
MBS6400193-01 0.1 mL

Complement Component C8 (Complement C8, Complement Component C8 alpha Chain, Complement Component 8 alpha Polypeptide, Complement Component 8 Subunit alpha, C8A, Complement Component C8 beta Chain, Complement Component 8 beta Polypeptide, Complement Compo

Sign In for Pricing
View Details
Complement Component C8 (Complement C8, Complement Component C8 alpha Chain, Complement Component 8 alpha Polypeptide, Complement Component 8 Subunit alpha, C8A, Complement Component C8 beta Chain, Complement Component 8 beta Polypeptide, Complement Compo
MBS6400193-02 5x 0.1 mL

Complement Component C8 (Complement C8, Complement Component C8 alpha Chain, Complement Component 8 alpha Polypeptide, Complement Component 8 Subunit alpha, C8A, Complement Component C8 beta Chain, Complement Component 8 beta Polypeptide, Complement Compo

Sign In for Pricing
View Details
GPR146 Antibody
ABD4951 100 µg

GPR146 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal to Human GPR108
MBS241415-01 0.05 mg

Rabbit Polyclonal to Human GPR108

Sign In for Pricing
View Details
Rabbit Polyclonal to Human GPR108
MBS241415-02 5x 0.05 mg

Rabbit Polyclonal to Human GPR108

Sign In for Pricing
View Details