Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NUDT1 protein

This Human NUDT1 protein spans the amino acid sequence from region 19-197aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2-hydroxy-dATP diphosphatase (EC, 3.6.1.56) 8-oxo-dGTPase Nucleoside diphosphate-linked moiety X motif 1 MTH1

UniProt

P36639

Expression Region

19-197aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-4 (Interleukin 4) CLIA Kit
MBS2531330-01 96 Tests

Mouse IL-4 (Interleukin 4) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-4 (Interleukin 4) CLIA Kit
MBS2531330-02 5x 96 Tests

Mouse IL-4 (Interleukin 4) CLIA Kit

Sign In for Pricing
View Details
Rap 2A/B/C (C-2) Alexa Fluor® 680
sc-515711 AF680 200 µg/mL

Rap 2A/B/C (C-2) Alexa Fluor® 680

Sign In for Pricing
View Details
Phospho-SMC1 (Ser957) Antibody
AF3878-01 100 µL

Phospho-SMC1 (Ser957) Antibody

Sign In for Pricing
View Details
Phospho-SMC1 (Ser957) Antibody
AF3878-02 200 µL

Phospho-SMC1 (Ser957) Antibody

Sign In for Pricing
View Details
Rabbit IgG Heavy Chain Antibody
MBS5313336-01 0.1 mL

Rabbit IgG Heavy Chain Antibody

Sign In for Pricing
View Details