Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi eglD protein

This Fungi eglD protein spans the amino acid sequence from region 21-408aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carboxymethylcellulase D Cellulase 61A Cellulase D cel61A

UniProt

Q96WQ9

Expression Region

21-408aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Aspergillus kawachii (strain NBRC 4308)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Methylbicyclo[2.2.1]heptane-2-carboxylic acid
HBA50822-01 50 mg

2-Methylbicyclo[2.2.1]heptane-2-carboxylic acid

Sign In for Pricing
View Details
2-Methylbicyclo[2.2.1]heptane-2-carboxylic acid
HBA50822-02 0.5 g

2-Methylbicyclo[2.2.1]heptane-2-carboxylic acid

Sign In for Pricing
View Details
Early Endosome Antigen 1 (EEA1) Antibody
abx136011-01 50 µL

Early Endosome Antigen 1 (EEA1) Antibody

Sign In for Pricing
View Details
Early Endosome Antigen 1 (EEA1) Antibody
abx136011-02 100 µL

Early Endosome Antigen 1 (EEA1) Antibody

Sign In for Pricing
View Details
Early Endosome Antigen 1 (EEA1) Antibody
abx136011-03 200 µL

Early Endosome Antigen 1 (EEA1) Antibody

Sign In for Pricing
View Details
Quick Step Rabbit Proliferating Cell Nuclear Antigen Antibody (Anti-PCNA) elisa Kit
QS0312Rb-01 48 Tests

Quick Step Rabbit Proliferating Cell Nuclear Antigen Antibody (Anti-PCNA) elisa Kit

Sign In for Pricing
View Details