Virus Enterobacteria phage T6 Beta-glucosyl-HMC-alpha-glucosyl-transferase protein
Selected Variant
GTR18883838-01
Size: 20 µg
This Virus Enterobacteria phage T6 Beta-glucosyl-HMC-alpha-glucosyl-transferase protein spans the amino acid sequence from region 1-280aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Beta-glucosyl-HMC-alpha-glucosyl-transferase, EC 2.4.1.
UniProt
Q06718
Expression Region
1-280aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Enterobacteria phage T6 (Bacteriophage T6)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
36.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MIQFVIPSYQRVGAVSALDMFPTDYEPHIVVREHEEKAYNDAYGSRAKIITIPDGVNGIAGTRKAITDMYAGQRIWMIDDDTTIRMSSMRKRDDRRCVDKVNQLTHEQFYELIQYVEDAMDCGYYHGHARLPIFKITSSWGNYRENSYGFTNTWYDLGKLTTEQIGYGKIDLCEDMYAFLNLINQGYPHLALFKYLVVSGKAQAPGGCSSIRSNSKHNRALEQINREFPEQARWKTSNIEKRKSLGEEDEPLKVLRMCVSRKEKSEAFHKFNAIHPIAVD
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881082-100 1x 100 µL
MHC II (HLA-DRA) (19-26.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471282-100 1x 100 µL
ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680823-100 1x 100 µL
P21 / WAF1 (CIP1/823), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040812-100 1x 100 µL
Tyrosinase (OCA1/812), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB2391-500 1x 500 µL
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC473606-100 1x 100 µL
Human Herpes Virus 8 (HHV8) (HHV8/3606), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details