Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Interferon gamma protein

This Human Interferon gamma protein spans the amino acid sequence from region 22-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

10 kDa interferon gamma-induced protein INP10, SCYB10

UniProt

P02778

Expression Region

22-98aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human EIF6 sgRNA gene knockout kit - Lentiviral human EIF6 sgRNA gene knockout kit (25)
GTR15394080 1 Vial

Lentiviral human EIF6 sgRNA gene knockout kit - Lentiviral human EIF6 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
FBXO8 Protein Vector (Mouse) (pPM-C-HA)
20346024 500 ng

FBXO8 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
DDX5 (NM_004396) Human Tagged ORF Clone Lentiviral Particle
RC200371L3V 200 µL

DDX5 (NM_004396) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human EXD2 knockout cell line
ABC-KH4973 1 Vial

Human EXD2 knockout cell line

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) FIXA Polyclonal Antibody
MBS7184060 Inquire

Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) FIXA Polyclonal Antibody

Sign In for Pricing
View Details
FABP2 (Fatty Acid Binding Protein 2, Intestinal, FABPI, IFABP, I-FABP, Intestinal-type fatty acid-binding protein)
363031 200 µL

FABP2 (Fatty Acid Binding Protein 2, Intestinal, FABPI, IFABP, I-FABP, Intestinal-type fatty acid-binding protein)

Sign In for Pricing
View Details