Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Interferon gamma protein

This Human Interferon gamma protein spans the amino acid sequence from region 22-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

10 kDa interferon gamma-induced protein INP10, SCYB10

UniProt

P02778

Expression Region

22-98aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque GIPC3 Protein, His (Fc)-Avi-tagged
GIPC3-1675R 50 µg

Recombinant Rhesus Macaque GIPC3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mrgprf sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7353205 3x 1.0 µg

Mrgprf sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
C9orf152 siRNA (Human)
orb1850120-01 15 nmol

C9orf152 siRNA (Human)

Sign In for Pricing
View Details
C9orf152 siRNA (Human)
orb1850120-02 30 nmol

C9orf152 siRNA (Human)

Sign In for Pricing
View Details
KRT18P35 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1173605 3x 1.0 µg

KRT18P35 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SCNN1A Antibody
CSB-PA435775-01 50 μL

SCNN1A Antibody

Sign In for Pricing
View Details