Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Atoh1 protein

This Mouse Atoh1 protein spans the amino acid sequence from region 1-351aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Helix-loop-helix protein mATH-1 Ath1

UniProt

P48985

Expression Region

1-351aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSRLLHAEEWAEVKELGDHHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNVGEQPPPPTASCKNDHHHLRTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPVQEDNSKTSPRSHRSDGEFSPHSHYSDSDEAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YY1 Antibody
orb619065 100 µL

YY1 Antibody

Sign In for Pricing
View Details
GPRC5D Rabbit Polyclonal Antibody
orb157375-01 50 μL

GPRC5D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPRC5D Rabbit Polyclonal Antibody
orb157375-02 100 µL

GPRC5D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPRC5D Rabbit Polyclonal Antibody
orb157375-03 200 µL

GPRC5D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Methylosome subunit pICln (CLNS1A) Canine ELISA Kit
E9757 96 Tests

Methylosome subunit pICln (CLNS1A) Canine ELISA Kit

Sign In for Pricing
View Details
Mouse Gipc1 Pre-designed siRNA Set B
SI105433B 1 Each

Mouse Gipc1 Pre-designed siRNA Set B

Sign In for Pricing
View Details