Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant LTP2 protein

This Plant LTP2 protein spans the amino acid sequence from region 32-133aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Par j II Major pollen allergen Par j 2.0101 Protein P2 Allergen, Par j 2.0101

UniProt

P55958

Expression Region

32-133aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Calcineurin Binding Protein 1 ELISA Kit
MBS748516-01 48 Well

Canine Calcineurin Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Calcineurin Binding Protein 1 ELISA Kit
MBS748516-02 96 Well

Canine Calcineurin Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Calcineurin Binding Protein 1 ELISA Kit
MBS748516-03 5x 96 Well

Canine Calcineurin Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Calcineurin Binding Protein 1 ELISA Kit
MBS748516-04 10x 96 Well

Canine Calcineurin Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Araguspongin B
TN7278-01 10 mg

Araguspongin B

Sign In for Pricing
View Details
Araguspongin B
TN7278-02 50 mg

Araguspongin B

Sign In for Pricing
View Details