Plant LTP2 protein
This Plant LTP2 protein spans the amino acid sequence from region 32-133aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Allergen Par j II Major pollen allergen Par j 2.0101 Protein P2 Allergen, Par j 2.0101
UniProt
P55958
Expression Region
32-133aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa)
Field of Research
Epigenetics
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
27.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
130092-PE 100 µL
Myotubular Myopathy 1 (MTM1, CNM, MTMX, Myotubularin, XLMTM, CG2, Myotubularin 1) (PE)
Sign In for Pricing
View Details 
MBS6193449-01 0.1 mL
XRCC2 (X-ray Repair Cross-complementing Protein 2, DNA Repair Protein XRCC2) (MaxLight 405)
Sign In for Pricing
View Details MBS6193449-02 5x 0.1 mL
XRCC2 (X-ray Repair Cross-complementing Protein 2, DNA Repair Protein XRCC2) (MaxLight 405)
Sign In for Pricing
View Details 
A2298-36-ML750 100 µL
A1-Antitrypsin (AAT, alpha-1-AT, alpha1 Proteinase Inhibitor, alpha1 PI) discontinued
Sign In for Pricing
View Details