Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish tnfb protein

This Zebrafish tnfb protein spans the amino acid sequence from region 101-242aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tnf TNF alpha

UniProt

Q4W898

Expression Region

101-242aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal VISTA/B7-H5/PD-1H Antibody (mam82) [DyLight 680]
NBP3-11974FR 0.1 mL

Mouse Monoclonal VISTA/B7-H5/PD-1H Antibody (mam82) [DyLight 680]

Sign In for Pricing
View Details
ZO-1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-34023R-BF750 100 µL

ZO-1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Mouse Chmp2a activation kit by CRISPRa
GA207990 1 Kit

Mouse Chmp2a activation kit by CRISPRa

Sign In for Pricing
View Details
IFN alpha 2a
100-446-L500 500 µg

IFN alpha 2a

Sign In for Pricing
View Details
OR4R1P CRISPR All-in-one AAV vector set (with saCas9)(Human)
35258151 3x 1.0 µg DNA

OR4R1P CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Lentiviral human GLA shRNA (UAS) - Lentiviral human GLA shRNA (UAS, RFP) (100)
GTR15078204 1 Vial

Lentiviral human GLA shRNA (UAS) - Lentiviral human GLA shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details