Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish tnfb protein

This Zebrafish tnfb protein spans the amino acid sequence from region 101-242aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tnf TNF alpha

UniProt

Q4W898

Expression Region

101-242aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SV2A (Synaptic Vesicle Glycoprotein 2a, KIAA0736, PSEC0174)
336179-01 50 µL

SV2A (Synaptic Vesicle Glycoprotein 2a, KIAA0736, PSEC0174)

Sign In for Pricing
View Details
SV2A (Synaptic Vesicle Glycoprotein 2a, KIAA0736, PSEC0174)
336179-02 100 µL

SV2A (Synaptic Vesicle Glycoprotein 2a, KIAA0736, PSEC0174)

Sign In for Pricing
View Details
ATR 3'UTR Lenti-reporter-Luc Vector
12833081 1.0 µg

ATR 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Solute Carrier Family 12 Member 2 (SLC12A2) Antibody
abx148545-01 50 µg

Solute Carrier Family 12 Member 2 (SLC12A2) Antibody

Sign In for Pricing
View Details
Solute Carrier Family 12 Member 2 (SLC12A2) Antibody
abx148545-02 100 µg

Solute Carrier Family 12 Member 2 (SLC12A2) Antibody

Sign In for Pricing
View Details
(S) -1- (4-Ethylphenyl) propan-1-amine hydrochloride
OR85169-01 100 mg

(S) -1- (4-Ethylphenyl) propan-1-amine hydrochloride

Sign In for Pricing
View Details