Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sfrp5 protein

This Mouse Sfrp5 protein spans the amino acid sequence from region 22-314aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sfrp5, Secreted frizzled-related protein 5, sFRP-5

UniProt

Q9WU66

Expression Region

22-314aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APTRGQEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDNLTGSFLVMGRKVEGQLLLTAVYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Goat IgG Fc-UNLB
6163-01 0.5 mg

Rabbit Anti-Goat IgG Fc-UNLB

Sign In for Pricing
View Details
Feline Herpesvirus Monoclonal antibody (conjugate)
E41H124 100 µg

Feline Herpesvirus Monoclonal antibody (conjugate)

Sign In for Pricing
View Details
Anti-CHP1 Antibody Picoband® FITC Conjugated
A04737-3-FITC 100 µg/Vial

Anti-CHP1 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Anti-Human CLTRN/Tmem27 Antibody (SAA1965)
HV808013-01 50 µg

Anti-Human CLTRN/Tmem27 Antibody (SAA1965)

Sign In for Pricing
View Details
Anti-Human CLTRN/Tmem27 Antibody (SAA1965)
HV808013-02 100 µg

Anti-Human CLTRN/Tmem27 Antibody (SAA1965)

Sign In for Pricing
View Details
Anti-Human CLTRN/Tmem27 Antibody (SAA1965)
HV808013-03 1 mg

Anti-Human CLTRN/Tmem27 Antibody (SAA1965)

Sign In for Pricing
View Details