Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish Transthyretin protein

This Zebrafish Transthyretin protein spans the amino acid sequence from region 20-149aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

B8JLL8

Expression Region

20-149aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVAFHGGSDAHCPLTVKILDAVKGTPAGNIALDLFRQDQGGTWEKIASGKVDMTGEVHNLITEQEFTPGVYRVEFDTLTYWKTEGRTPFHQLADVVFEAHAEGHRHYTLALLLSPFSYTTTAVVVKAHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Methyl-2- (thiomorpholin-4-yl) propan-1-amine dihydrochloride
XLD05190-01 50 mg

2-Methyl-2- (thiomorpholin-4-yl) propan-1-amine dihydrochloride

Sign In for Pricing
View Details
2-Methyl-2- (thiomorpholin-4-yl) propan-1-amine dihydrochloride
XLD05190-02 0.5 g

2-Methyl-2- (thiomorpholin-4-yl) propan-1-amine dihydrochloride

Sign In for Pricing
View Details
IL20RA polyclonal antibody
BS60687-01 50 µL

IL20RA polyclonal antibody

Sign In for Pricing
View Details
IL20RA polyclonal antibody
BS60687-02 100 µL

IL20RA polyclonal antibody

Sign In for Pricing
View Details
Exportin-2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61865R-BF488-TR 20 µL

Exportin-2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
RAPGEF5 Rabbit Polyclonal Antibody (Fluoro594)
orb3094223 100 µg

RAPGEF5 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details