Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish Transthyretin protein

This Zebrafish Transthyretin protein spans the amino acid sequence from region 20-149aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

B8JLL8

Expression Region

20-149aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVAFHGGSDAHCPLTVKILDAVKGTPAGNIALDLFRQDQGGTWEKIASGKVDMTGEVHNLITEQEFTPGVYRVEFDTLTYWKTEGRTPFHQLADVVFEAHAEGHRHYTLALLLSPFSYTTTAVVVKAHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oscar sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
35761116 3x 1.0 µg

Oscar sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal 14-3-3 gamma Antibody (AT4B9) [Alexa Fluor 700]
NBP2-50579AF700 100 µL

Mouse Monoclonal 14-3-3 gamma Antibody (AT4B9) [Alexa Fluor 700]

Sign In for Pricing
View Details
LDLR Recombinant Monoclonal Antibody [2B10]
A74277-050 50 µL

LDLR Recombinant Monoclonal Antibody [2B10]

Sign In for Pricing
View Details
MCM10 Antibody
19-656 100 µL

MCM10 Antibody

Sign In for Pricing
View Details
Taok1 Mouse shRNA Lentiviral Particle (Locus ID 216965)
TL519661V 500 µL Each

Taok1 Mouse shRNA Lentiviral Particle (Locus ID 216965)

Sign In for Pricing
View Details
Phospho-MEF2C (S396) Antibody
A24432-50UG 50 µg

Phospho-MEF2C (S396) Antibody

Sign In for Pricing
View Details