Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish Transthyretin protein

This Zebrafish Transthyretin protein spans the amino acid sequence from region 20-149aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

B8JLL8

Expression Region

20-149aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVAFHGGSDAHCPLTVKILDAVKGTPAGNIALDLFRQDQGGTWEKIASGKVDMTGEVHNLITEQEFTPGVYRVEFDTLTYWKTEGRTPFHQLADVVFEAHAEGHRHYTLALLLSPFSYTTTAVVVKAHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2’-Deoxyguanosine Monohydrate
TRC-D239550-100MG 100 mg

2’-Deoxyguanosine Monohydrate

Sign In for Pricing
View Details
RNF149 Mouse Monoclonal Antibody [Clone 8D7]
E45M19731V-2 50 µL

RNF149 Mouse Monoclonal Antibody [Clone 8D7]

Sign In for Pricing
View Details
Porcine Transthyretin (TTR) ELISA Kit
RDR-TTR-p-01 96 Tests

Porcine Transthyretin (TTR) ELISA Kit

Sign In for Pricing
View Details
Porcine Transthyretin (TTR) ELISA Kit
RDR-TTR-p-02 48 Tests

Porcine Transthyretin (TTR) ELISA Kit

Sign In for Pricing
View Details
Pigeon Elastase ELISA Kit
MBS089181 Inquire

Pigeon Elastase ELISA Kit

Sign In for Pricing
View Details
Goat anti Mouse IgG2a (Alk Phos)
MBS539198-01 0.5 mg

Goat anti Mouse IgG2a (Alk Phos)

Sign In for Pricing
View Details