Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish Transthyretin protein

This Zebrafish Transthyretin protein spans the amino acid sequence from region 20-149aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

B8JLL8

Expression Region

20-149aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVAFHGGSDAHCPLTVKILDAVKGTPAGNIALDLFRQDQGGTWEKIASGKVDMTGEVHNLITEQEFTPGVYRVEFDTLTYWKTEGRTPFHQLADVVFEAHAEGHRHYTLALLLSPFSYTTTAVVVKAHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HJC0350
S7500-200mg 200 mg

HJC0350

Sign In for Pricing
View Details
Rat Anti-Mouse CD38-FITC
31-1888-0.5 0.5 mg

Rat Anti-Mouse CD38-FITC

Sign In for Pricing
View Details
Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42), Biotinylated
orb3008446-01 20 µg

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42), Biotinylated
orb3008446-02 100 µg

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42), Biotinylated
orb3008446-03 1 mg

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42), Biotinylated

Sign In for Pricing
View Details
Rat Ccdc120 Pre-designed siRNA Set B
SI202079B 1 Each

Rat Ccdc120 Pre-designed siRNA Set B

Sign In for Pricing
View Details