Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GP1BA protein

This Human GP1BA protein spans the amino acid sequence from region 553-652aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen CD42b-alpha CD_antigen, CD42b

UniProt

P07359

Expression Region

553-652aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mbl1 shRNA (UAS) - Lentiviral mouse Mbl1 shRNA (UAS, RFP) plasmid
GTR15168865 1 Vial

Lentiviral mouse Mbl1 shRNA (UAS) - Lentiviral mouse Mbl1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Camel PH Domain Leucine-Rich Repeat-Containing Protein Phosphatase 1 (PHLPP) ELISA Kit
MBS9375613-01 48 Well

Camel PH Domain Leucine-Rich Repeat-Containing Protein Phosphatase 1 (PHLPP) ELISA Kit

Sign In for Pricing
View Details
Camel PH Domain Leucine-Rich Repeat-Containing Protein Phosphatase 1 (PHLPP) ELISA Kit
MBS9375613-02 96 Well

Camel PH Domain Leucine-Rich Repeat-Containing Protein Phosphatase 1 (PHLPP) ELISA Kit

Sign In for Pricing
View Details
Camel PH Domain Leucine-Rich Repeat-Containing Protein Phosphatase 1 (PHLPP) ELISA Kit
MBS9375613-03 5x 96 Well

Camel PH Domain Leucine-Rich Repeat-Containing Protein Phosphatase 1 (PHLPP) ELISA Kit

Sign In for Pricing
View Details
Camel PH Domain Leucine-Rich Repeat-Containing Protein Phosphatase 1 (PHLPP) ELISA Kit
MBS9375613-04 10x 96 Well

Camel PH Domain Leucine-Rich Repeat-Containing Protein Phosphatase 1 (PHLPP) ELISA Kit

Sign In for Pricing
View Details
Anti-DMXL2 Antibody (R4D59)
RHP11601 100 μg

Anti-DMXL2 Antibody (R4D59)

Sign In for Pricing
View Details