Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NUDT1 protein

This Human NUDT1 protein spans the amino acid sequence from region 19-197aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2-hydroxy-dATP diphosphatase (EC, 3.6.1.56) 8-oxo-dGTPase Nucleoside diphosphate-linked moiety X motif 1 MTH1

UniProt

P36639

Expression Region

19-197aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL1RL1/ST2 Protein (His Tag)
PKSM041050-01 10 µg

Recombinant Mouse IL1RL1/ST2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL1RL1/ST2 Protein (His Tag)
PKSM041050-02 50 µg

Recombinant Mouse IL1RL1/ST2 Protein (His Tag)

Sign In for Pricing
View Details
Streptavidin (SA) . Recombinant, Pan-species, His-Tag
051842-01 10 µg

Streptavidin (SA) . Recombinant, Pan-species, His-Tag

Sign In for Pricing
View Details
Streptavidin (SA) . Recombinant, Pan-species, His-Tag
051842-02 50 µg

Streptavidin (SA) . Recombinant, Pan-species, His-Tag

Sign In for Pricing
View Details
Streptavidin (SA) . Recombinant, Pan-species, His-Tag
051842-03 100 µg

Streptavidin (SA) . Recombinant, Pan-species, His-Tag

Sign In for Pricing
View Details
Streptavidin (SA) . Recombinant, Pan-species, His-Tag
051842-04 200 µg

Streptavidin (SA) . Recombinant, Pan-species, His-Tag

Sign In for Pricing
View Details