Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NUDT1 protein

This Human NUDT1 protein spans the amino acid sequence from region 19-197aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2-hydroxy-dATP diphosphatase (EC, 3.6.1.56) 8-oxo-dGTPase Nucleoside diphosphate-linked moiety X motif 1 MTH1

UniProt

P36639

Expression Region

19-197aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS18 Recombinant Antibody
bsm-62108R-TR 20 µL

RGS18 Recombinant Antibody

Sign In for Pricing
View Details
MAST3 Antibody, FITC conjugated
CSB-PA013513LC01HU-01 50 µg

MAST3 Antibody, FITC conjugated

Sign In for Pricing
View Details
MAST3 Antibody, FITC conjugated
CSB-PA013513LC01HU-02 100 µg

MAST3 Antibody, FITC conjugated

Sign In for Pricing
View Details
SIRT1 Antibody
orb1252964 0.1 mg

SIRT1 Antibody

Sign In for Pricing
View Details
plakophilin 2 Lentiviral Activation Particles (h)
sc-402990-LAC 200 µL

plakophilin 2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Recombinant Human GATA-2 Protein - (Dry Ice)
H00002624-Q01-25ug 25 µg

Recombinant Human GATA-2 Protein - (Dry Ice)

Sign In for Pricing
View Details