Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NUDT1 protein

This Human NUDT1 protein spans the amino acid sequence from region 19-197aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2-hydroxy-dATP diphosphatase (EC, 3.6.1.56) 8-oxo-dGTPase Nucleoside diphosphate-linked moiety X motif 1 MTH1

UniProt

P36639

Expression Region

19-197aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-643 miRNA Agomir
abx880419-01 5 nmol

Human hsa-miR-643 miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-643 miRNA Agomir
abx880419-02 10 nmol

Human hsa-miR-643 miRNA Agomir

Sign In for Pricing
View Details
Creg1 3'UTR GFP Stable Cell Line
TU252784 1.0 mL

Creg1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
384 Well Flat Bottom ELISA Plates, 130μL, Undetachable
EP60014H 130μL x 384, flat bottom

384 Well Flat Bottom ELISA Plates, 130μL, Undetachable

Sign In for Pricing
View Details
General Noradrenaline ELISA Kit
EK2432 Inquire

General Noradrenaline ELISA Kit

Sign In for Pricing
View Details
7-Bromo-5-fluoro-1-indanone
KAC01695-01 10 g

7-Bromo-5-fluoro-1-indanone

Sign In for Pricing
View Details