Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus AUR1 protein

This Virus AUR1 protein spans the amino acid sequence from region 313-401aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aureobasidin A resistance protein Phosphatidylinositol, ceramide phosphoinositol transferase

UniProt

P36107

Expression Region

313-401aa

Tag

N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moesin (MSN) Recombinant, Human
155896-01 10 µg

Moesin (MSN) Recombinant, Human

Sign In for Pricing
View Details
Moesin (MSN) Recombinant, Human
155896-02 50 µg

Moesin (MSN) Recombinant, Human

Sign In for Pricing
View Details
Moesin (MSN) Recombinant, Human
155896-03 200 µg

Moesin (MSN) Recombinant, Human

Sign In for Pricing
View Details
N5- (4-Chlorophenyl) pyridine-2,5-diamine hydrochloride
FDD55425-01 50 mg

N5- (4-Chlorophenyl) pyridine-2,5-diamine hydrochloride

Sign In for Pricing
View Details
N5- (4-Chlorophenyl) pyridine-2,5-diamine hydrochloride
FDD55425-02 0.5 g

N5- (4-Chlorophenyl) pyridine-2,5-diamine hydrochloride

Sign In for Pricing
View Details
N-Methyl-3- (trifluoromethyl) aniline
459414-01 100 mg

N-Methyl-3- (trifluoromethyl) aniline

Sign In for Pricing
View Details