Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HGD protein

This Human HGD protein spans the amino acid sequence from region 1-445aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Homogentisate oxygenase Homogentisic acid oxidase Homogentisicase

UniProt

Q93099

Expression Region

1-445aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human prothrombin fragment 1+2, F1+2 ELISA Kit
MBS163939-01 48 Well

Human prothrombin fragment 1+2, F1+2 ELISA Kit

Sign In for Pricing
View Details
Human prothrombin fragment 1+2, F1+2 ELISA Kit
MBS163939-02 96 Well

Human prothrombin fragment 1+2, F1+2 ELISA Kit

Sign In for Pricing
View Details
Human prothrombin fragment 1+2, F1+2 ELISA Kit
MBS163939-03 5x 96 Well

Human prothrombin fragment 1+2, F1+2 ELISA Kit

Sign In for Pricing
View Details
Human prothrombin fragment 1+2, F1+2 ELISA Kit
MBS163939-04 10x 96 Well

Human prothrombin fragment 1+2, F1+2 ELISA Kit

Sign In for Pricing
View Details
IL-22 (Interleukin 22) Chicken ELISA Kit
E2118 96 Tests

IL-22 (Interleukin 22) Chicken ELISA Kit

Sign In for Pricing
View Details
TSP Focus Spectrachrom D2 Lamp
LMP2034 1 Each

TSP Focus Spectrachrom D2 Lamp

Sign In for Pricing
View Details