Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria scn protein

This Bacteria scn protein spans the amino acid sequence from region 32-116aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Scn, SA1754, Staphylococcal complement inhibitor, SCIN

UniProt

Q99SU9

Expression Region

32-116aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain N315)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DQA1 Protein Vector (Human) (pPM-C-HA)
PV053119 500 ng

HLA-DQA1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-amyloid-beta VHH antibody
JOT0138-1-2000 2000

Anti-amyloid-beta VHH antibody

Sign In for Pricing
View Details
Gja5 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4388402 1.0 µg DNA

Gja5 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Treponema pallidum/TP tmpA Protein, C-His
orb2966492-01 50 µg

Recombinant Treponema pallidum/TP tmpA Protein, C-His

Sign In for Pricing
View Details
Recombinant Treponema pallidum/TP tmpA Protein, C-His
orb2966492-02 100 µg

Recombinant Treponema pallidum/TP tmpA Protein, C-His

Sign In for Pricing
View Details
Recombinant Treponema pallidum/TP tmpA Protein, C-His
orb2966492-03 1 mg

Recombinant Treponema pallidum/TP tmpA Protein, C-His

Sign In for Pricing
View Details