Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RFC1 protein

This Human RFC1 protein spans the amino acid sequence from region 402-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activator 1 140 kDa subunit

UniProt

P35251

Expression Region

402-492aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CES1 (A-11) Alexa Fluor® 488
sc-365249 AF488 200 µg/mL

CES1 (A-11) Alexa Fluor® 488

Sign In for Pricing
View Details
Cytokeratin 14 Rabbit mAb
C05965-100uL 100 µL

Cytokeratin 14 Rabbit mAb

Sign In for Pricing
View Details
Rat Eif3i protein
orb594972-01 20 µg

Rat Eif3i protein

Sign In for Pricing
View Details
Rat Eif3i protein
orb594972-02 100 µg

Rat Eif3i protein

Sign In for Pricing
View Details
Rat Eif3i protein
orb594972-03 1 mg

Rat Eif3i protein

Sign In for Pricing
View Details
RTC-5 500mg
A19067-500 500 mg

RTC-5 500mg

Sign In for Pricing
View Details