Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RFC1 protein

This Human RFC1 protein spans the amino acid sequence from region 402-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activator 1 140 kDa subunit

UniProt

P35251

Expression Region

402-492aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BANF1 Recombinant Antibody
bsm-54435R-TR 20 µL

BANF1 Recombinant Antibody

Sign In for Pricing
View Details
Ankyrin repeat, SAM and Basic leucine zipper domain-containing protein 1 (ASZ1) Bovine ELISA Kit
B5272 96 Tests

Ankyrin repeat, SAM and Basic leucine zipper domain-containing protein 1 (ASZ1) Bovine ELISA Kit

Sign In for Pricing
View Details
Phospho-NR1D1 (Ser55 + Ser59) Rabbit Polyclonal Antibody (AP)
orb900595 100 µL

Phospho-NR1D1 (Ser55 + Ser59) Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Beta Arrestin 1 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61185R-PE-Cy5-TR 20 µL

Beta Arrestin 1 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
(3-Bromo-1-propyn-1-yl) cyclopropane
CJB52608 2.5 g

(3-Bromo-1-propyn-1-yl) cyclopropane

Sign In for Pricing
View Details
Sqstm1 (Sequestosome-1, STONE14, Ubiquitin-Binding Protein p62, Sqstm1, A170, STAP) (APC)
MBS6459485-01 0.2 mL

Sqstm1 (Sequestosome-1, STONE14, Ubiquitin-Binding Protein p62, Sqstm1, A170, STAP) (APC)

Sign In for Pricing
View Details